DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11L and CG34375

DIOPT Version :9

Sequence 1:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:152 Identity:29/152 - (19%)
Similarity:57/152 - (37%) Gaps:56/152 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1000 LGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGMSLVGLPLSTCQSYIRN--- 1061
            ||:.:..:.|.   |...::.:.:..:|.| |.:.:||.|:.:||..::||.:|...:.:::   
  Fly    15 LGLNLSRAPWD---PYPWVSGVQAKSSAER-GGVRLGDTLLELNGADVLGLKISELANRLQDHWQ 75

  Fly  1062 ---------------------------------AKNQTAVKFT--------VVPCPPVVEVKILR 1085
                                             ...|:..||.        ::.||..:||  ::
  Fly    76 SGAEVVTLMMWRQQANIDPNEDPAEASHAVQHGINQQSLQKFATCLQHISQLLECPVCLEV--IK 138

  Fly  1086 PKALFQLGFSVQNG-VICSLLR 1106
            |.     |:...|| |:|:..|
  Fly   139 PP-----GWQCCNGHVLCNNCR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919
PDZ_signaling 988..1065 CDD:238492 15/100 (15%)
PDZ_signaling 1092..1151 CDD:238492 6/16 (38%)
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 15/74 (20%)
RING 129..168 CDD:238093 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.