powered by:
Protein Alignment X11L and synj2bp
DIOPT Version :9
Sequence 1: | NP_001285376.1 |
Gene: | X11L / 252671 |
FlyBaseID: | FBgn0026313 |
Length: | 1170 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956211.1 |
Gene: | synj2bp / 334599 |
ZFINID: | ZDB-GENE-030131-6531 |
Length: | 152 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 17/47 - (36%) |
Similarity: | 26/47 - (55%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1016 VVIANLMSSGAAARCGQLNIGDQLIAINGMSLVGLPLSTCQSYIRNA 1062
:.:|.:..:||||..|:|..||:::||||..|..|.........|:|
Zfish 42 IYVAKIKENGAAALDGRLQEGDKILAINGRKLDNLSHGAAVELFRSA 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.