Protein Alignment X11L and Cytip

DIOPT Version :9

• Sequence 1: NP_001285376.1
• Gene: X11L / 252671
• FlyBaseID: FBgn0026313
• Length: 1170
• Species: Drosophila melanogaster
• Sequence 2: NP_001012086.1
• Gene: Cytip / 311047
• RGDID: 1307990
• Length: 359
• Species: Rattus norvegicus
• Alignment Length: 79
• Identity: 18/79 - (22%)
• Similarity: 31/79 - (39%)
• Gaps: 14/79 - (17%)

  Fly  1093 GFSVQN--------------GVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHDTIVKLLSS 1143
            ||.:|.              .:||.:.....|...|::||.....:|..|.....|..:|.|:.|
  Rat    89 GFEIQTYRLQNQNICSSEVCTMICKVQEDSPAHCAGLQVGDIFANVNGVSTEGFTHKQVVDLIRS 153

  Fly  1144 SVGEILMKTMPTSM 1157
            |...:.::|:..:|
  Rat   154 SGNLLTIETLNGTM 167

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
X11L	NP_001285376.1	PTB_X11	775..954	CDD:269919
		PDZ_signaling	988..1065	CDD:238492
		PDZ_signaling	1092..1151	CDD:238492	16/71 (23%)
Cytip	NP_001012086.1	PDZ_signaling	76..161	CDD:238492	16/71 (23%)
		Interaction with CYTH1. /evidence=ECO:0000250	166..188		1/2 (50%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900