DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11L and Stxbp4

DIOPT Version :9

Sequence 1:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:341 Identity:69/341 - (20%)
Similarity:124/341 - (36%) Gaps:90/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 NPNPMNNSKPQTYSTATIRQGIG-----TSLTPNSPD----ICQIVGTTDISISSPEKLQFTKSP 747
            :|....:.:|||.:...:....|     ||.||.:.|    .|.::.|      .||..|...:|
  Rat   122 SPPVSEDCEPQTSAFNLLSSPAGTLLPKTSSTPRTQDSILPSCTVIQT------QPEHSQAGLAP 180

  Fly   748 TGSIKSL-KDSANSD------KKAKSRNKEGLLEP--KVLIEGVLFRARYLGSTQLVCEGQPTKS 803
            ..|:.:. .|::|:|      ..|.....:..|.|  ::..|.:.....|||.       ||||.
  Rat   181 VPSLNNRPTDTSNADIAPAWTDDASGPQGKISLNPSARLKAEKLEMALNYLGI-------QPTKE 238

  Fly   804 TRMMQAEEAVSRIKALAPEGESQPSTEVDLFISTEK-IMVLNTDLKEIMM-DHALRTISYIADIG 866
                |.|....:::|     :|:.:.....|:...: :..|..|  |:.: ||.|          
  Rat   239 ----QHEALRQQVQA-----DSEGTVSFGDFVQVARNLFCLQLD--EVNVGDHEL---------- 282

  Fly   867 DLVVLMARRRFVPNSVVDPSITSPLGDVPTPGIG----------EEESPPKEPLSKHNRTPKMIC 921
                         .||:|..:. |.|.:....:|          ||....||.|.:..:..|.:.
  Rat   283 -------------PSVLDSQLL-PCGSLEADEVGRLRQERNAALEERDALKEKLLESEKHRKQLI 333

  Fly   922 HVFESDEAQFIAQSIGQAFQVAYMEFLKANGIENESLAKEMDYQEVLNSQEIFGDELEI------ 980
            ...::.:.:  |:::.:..:........|...:.::...||||:||:...|....||:.      
  Rat   334 EELQNVKQE--AKAVAEETRALRSRIHLAEAAQRQARGMEMDYEEVIRLLEAEVSELKARLADYS 396

  Fly   981 ----FAKKELQKEVVV 992
                .:.::|:|.|.|
  Rat   397 DQNKESVQDLRKRVTV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919 34/192 (18%)
PDZ_signaling 988..1065 CDD:238492 3/5 (60%)
PDZ_signaling 1092..1151 CDD:238492
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492
TPR_MLP1_2 299..400 CDD:285204 18/102 (18%)
GBP_C <306..389 CDD:303769 16/84 (19%)
coiled coil 359..369 CDD:293879 1/9 (11%)
coiled coil 378..389 CDD:293879 2/10 (20%)
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.