DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11L and Tamalin

DIOPT Version :9

Sequence 1:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_620249.1 Gene:Tamalin / 192254 RGDID:70554 Length:394 Species:Rattus norvegicus


Alignment Length:249 Identity:54/249 - (21%)
Similarity:88/249 - (35%) Gaps:53/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 DVPTPGIGEEESPPKEPLSKHNRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIENES 957
            ::.|.|:...|....|.::       .:|.|.||..||....:.|..  :|.:..|...||.:..
  Rat   114 EIQTYGLHHREEQRVEMVT-------FVCRVHESSPAQLAGLTPGDT--IASVNGLNVEGIRHRE 169

  Fly   958 LAKEMDYQ-EVLNSQEIFGDEL---EIFAKKELQKEVVVPKAKGEILGVVIVESG--WGSMLPTV 1016
            :...:... .||..:.::|..:   |:.|:.:..|:.:..| .||...:::.|..  .|.::...
  Rat   170 IVDIIKASGNVLRLETLYGTSIRKAELEARLQYLKQTLYEK-WGEYRSLMVQEQRLVHGLVVKDP 233

  Fly  1017 VIANLMSS------GAAARCGQLNIGDQLIAINGMSLVGLPLSTCQSYIRNAKNQT--AVKFT-- 1071
            .|.:.:.|      ||....|.|..|..|.|..|          .:...|.||..|  ||..|  
  Rat   234 SIYDTLESVRSCLYGAGLLPGSLPFGPLLAAPGG----------ARGGSRRAKGDTDDAVYHTCF 288

  Fly  1072 -------VVPCPPVVEVKILRPKALFQLGFSVQN--GVICSLLRGGIAERGGVR 1116
                   .:|.||        |.|......|.:.  .|:|...|..::....||
  Rat   289 FGGAEPQALPPPP--------PPARAPGPGSAETPASVLCPAPRATLSRSASVR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919 14/60 (23%)
PDZ_signaling 988..1065 CDD:238492 19/84 (23%)
PDZ_signaling 1092..1151 CDD:238492 6/27 (22%)
TamalinNP_620249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PDZ_signaling 99..184 CDD:238492 17/78 (22%)
Interaction with PSCD3. /evidence=ECO:0000250 180..257 16/77 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..318 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.