powered by:
Protein Alignment X11L and F40F9.3
DIOPT Version :9
Sequence 1: | NP_001285376.1 |
Gene: | X11L / 252671 |
FlyBaseID: | FBgn0026313 |
Length: | 1170 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505503.1 |
Gene: | F40F9.3 / 185542 |
WormBaseID: | WBGene00009581 |
Length: | 275 |
Species: | Caenorhabditis elegans |
Alignment Length: | 104 |
Identity: | 25/104 - (24%) |
Similarity: | 40/104 - (38%) |
Gaps: | 36/104 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1031 GQLNIGDQLIAINGMSLVGLPLSTCQSYIRNAKNQTAVKFTVVPCPPVVEVKILRPKALFQLGFS 1095
|..|:.|::|.::| :....||| |..:: ||.|:.|.
Worm 108 GIFNVADRIIDVDG-----------EPVYDNAK-----------CKGLL-VKALKEKK------- 142
Fly 1096 VQNGVICSLL-RGGIAERGGVRVGHRIIEINNQSVVAVP 1133
:|:|| ..||.|.......:.:.|.:.|||:|.|
Worm 143 -----VCTLLIERGITESALKDATNEMNEEHTQSVMAPP 176
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.