DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11L and smz-2

DIOPT Version :9

Sequence 1:NP_001285376.1 Gene:X11L / 252671 FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_491965.1 Gene:smz-2 / 172415 WormBaseID:WBGene00020661 Length:274 Species:Caenorhabditis elegans


Alignment Length:191 Identity:41/191 - (21%)
Similarity:72/191 - (37%) Gaps:63/191 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   989 EVVVPKAKGEILGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGMSLVGLPLS 1053
            |:.:...:||.||....:    .::.|.:.|..:|.      |:|.||||:..:||.:     ..
 Worm     8 EICIDMEEGEPLGATPND----KLVITKIQAGTISE------GKLRIGDQVKKVNGQN-----CK 57

  Fly  1054 TCQSYIRNAKNQTAVKFTVVPCP--------------------PVVEVKILRPKALF-------- 1090
            .|..:.|      |::| ..||.                    |....||::.:..:        
 Worm    58 DCNDFFR------ALRF-AAPCAKITVNRDEKKAEELEARVHIPEDRAKIIQRREGYVYELATLV 115

  Fly  1091 ------QLGFSV---QNGVICSLL-RGGIAERGGVRVGHRIIEINNQSV--VAVPHDTIVK 1139
                  :||..:   ||.|:.|.: .|.:||:..| :|..:.:::...|  ..|..|.:||
 Worm   116 WVQNGPKLGLGIKHFQNRVLVSRVDPGSLAEKCLV-LGDHLCDVDGIPVSDKDVARDLLVK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919
PDZ_signaling 988..1065 CDD:238492 18/75 (24%)
PDZ_signaling 1092..1151 CDD:238492 16/54 (30%)
smz-2NP_491965.1 PDZ_signaling 7..77 CDD:238492 22/90 (24%)
PDZ_signaling 114..188 CDD:238492 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.