DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment X11L and cytip

DIOPT Version :9

Sequence 1:	NP_001285376.1	Gene:	X11L / 252671	FlyBaseID:	FBgn0026313	Length:	1170	Species:	Drosophila melanogaster
Sequence 2:	XP_003199223.2	Gene:	cytip / 100537036	ZFINID:	ZDB-GENE-140106-76	Length:	343	Species:	Danio rerio

Alignment Length:	143	Identity:	31/143 - (21%)
Similarity:	60/143 - (41%)	Gaps:	20/143 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly  1042 INGMSLVGLPLSTCQSYIRNAKNQTAVKFTVVPCPPVVEVKILRPKALFQLGFSVQN-GV----- 1100
            :|...:.|..||  ||.:....:.:.|.:|    .|...:.:|..:.....||.||. |:
Zfish    45 LNTEGMKGRTLS--QSQLARTHSNSLVDYT----DPQRTMVVLEKQDNEVFGFEVQTYGLKVKNT 103

  Fly  1101 --------ICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHDTIVKLLSSSVGEILMKTMPTSM 1157
                    :|.:..|..||..|:..|..|:.:|..|:....|..|::|:..|...:.::|:..|:
Zfish   104 SMVEMCTFVCRVQDGSAAETAGLTAGDIILSVNGVSIEGSTHQNIIELIRESSNTLKLETVSGSV 168

  Fly  1158 FRLLTGQETPIYI 1170
            .:.:..::...|:
Zfish   169 MKRIELEKKMHYL 181

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
X11L	NP_001285376.1	PTB_X11	775..954	CDD:269919
		PDZ_signaling	988..1065	CDD:238492	6/22 (27%)
		PDZ_signaling	1092..1151	CDD:238492	18/72 (25%)
cytip	XP_003199223.2	PDZ_signaling	78..162	CDD:238492	19/83 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900