DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdgfra and Cad96Ca

DIOPT Version :9

Sequence 1:NP_036934.1 Gene:Pdgfra / 25267 RGDID:3284 Length:1088 Species:Rattus norvegicus
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:413 Identity:135/413 - (32%)
Similarity:201/413 - (48%) Gaps:102/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat   584 RWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMT 648
            ||||||..|....|||.||||:|....|..::.::.:..||||.||.:|...:::.|:|||::|.
  Fly   462 RWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMK 526

  Rat   649 HLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSRHPEKPKKDLDIFGLNPAD 713
            .|.||:|:|:|||.||...|.::|.||...|.|..||   |.|...||          :|     
  Fly   527 SLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYL---RSSRAERH----------YG----- 573

  Rat   714 ESTRSYVILSFENNGDYVDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEAK 778
                                                                        ::..|
  Fly   574 ------------------------------------------------------------NTHGK 578

  Rat   779 NLLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIM 843
                   |..||..||.||.||||:||::|.|:..:||||||||:|:......|:.|||.|||::
  Fly   579 -------SNVLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVI 636

  Rat   844 HDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGVLLWEIFSLGGTPYPGMMVDSTFYNKI 908
            ....|..|....||::|||.||::||:::..||:||:|:|:|||.:||.|||||:.. :....|:
  Fly   637 TSKIYERKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISA-ADVMRKV 700

  Rat   909 KSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDH 973
            :.|||:.||:|...|:|.||..||:.:|::||.|..:.::::.||         ...:|:::.: 
  Fly   701 RDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL---------HTEMDYIELE- 755

  Rat   974 PAVARMRVDSDNAYIGVTYKNEE 996
                  |....|.|..|:...|:
  Fly   756 ------RFPDHNYYNIVSLSGEK 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdgfraNP_036934.1 Ig_3 27..99 CDD:404760
Ig 211..309 CDD:416386
Ig strand A 211..215 CDD:409353
Ig strand A' 222..226 CDD:409353
Ig strand B 228..237 CDD:409353
Ig strand C 242..247 CDD:409353
Ig strand C' 250..252 CDD:409353
Ig strand D 256..264 CDD:409353
Ig strand E 268..276 CDD:409353
Ig strand F 286..292 CDD:409353
Ig strand G 297..303 CDD:409353
Ig4_PDGFR 312..412 CDD:409445
Ig strand B 332..336 CDD:409445
Ig strand C 345..349 CDD:409445
Ig strand E 376..380 CDD:409445
Ig strand F 390..395 CDD:409445
Ig strand G 403..406 CDD:409445
PTKc_PDGFR_alpha 554..955 CDD:173653 129/370 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1017..1088
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 121/356 (34%)
PTKc 474..742 CDD:270623 120/353 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.