DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdgfra and drpr

DIOPT Version :9

Sequence 1:NP_036934.1 Gene:Pdgfra / 25267 RGDID:3284 Length:1088 Species:Rattus norvegicus
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:262 Identity:54/262 - (20%)
Similarity:85/262 - (32%) Gaps:104/262 - (39%)


- Green bases have known domain annotations that are detailed below.


  Rat   844 HDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGVLLWEIFSLGGTPYPGMMVDSTFY-NK 907
            ||:|         |..| .|...|||                        |..||..::... |.
  Fly   840 HDTN---------PPSW-PPNHNFDN------------------------PVYGMQAETRLLPNN 870

  Rat   908 IKSGYRMAKPD-------------HATSEV--------YEIMVQCWNSEPEKRPSFYHLSEIVEN 951
            ::|  :|...|             :|:..|        ::::.:..|:: ...|..|:.|...|:
  Fly   871 MRS--KMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNAD-RTNPIVYNESLKEEH 932

  Rat   952 LL-----PGQYK---KSYEKI--------HLDFLK---SDHPAVARMRVDSDNAYIGVTYKNEED 997
            :.     ...||   |.|.||        |||:.:   |..|...||    ::|.:.:..     
  Fly   933 VYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRM----NDAMLNINQ----- 988

  Rat   998 KLKEWEGGLDEQRLSADSGYII----PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTF 1058
                     ||::.|......:    |||..:|.|:.|.....|.:....|..|.    |||..|
  Fly   989 ---------DEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTASP----SSSPKF 1040

  Rat  1059 IK 1060
            :|
  Fly  1041 LK 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdgfraNP_036934.1 Ig_3 27..99 CDD:404760
Ig 211..309 CDD:416386
Ig strand A 211..215 CDD:409353
Ig strand A' 222..226 CDD:409353
Ig strand B 228..237 CDD:409353
Ig strand C 242..247 CDD:409353
Ig strand C' 250..252 CDD:409353
Ig strand D 256..264 CDD:409353
Ig strand E 268..276 CDD:409353
Ig strand F 286..292 CDD:409353
Ig strand G 297..303 CDD:409353
Ig4_PDGFR 312..412 CDD:409445
Ig strand B 332..336 CDD:409445
Ig strand C 345..349 CDD:409445
Ig strand E 376..380 CDD:409445
Ig strand F 390..395 CDD:409445
Ig strand G 403..406 CDD:409445
PTKc_PDGFR_alpha 554..955 CDD:173653 23/137 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1017..1088 14/48 (29%)
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.