DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Id1 and tap

DIOPT Version :9

Sequence 1:XP_006235329.1 Gene:Id1 / 25261 RGDID:2858 Length:154 Species:Rattus norvegicus
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:75 Identity:21/75 - (28%)
Similarity:40/75 - (53%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


  Rat    59 LYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRAPLS 123
            ::::|....:|:..:|:||:..|::|:|||:...:||..|:       :|..:||   .:...|.
  Fly   167 MHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALE-------QVLESGG---SINLDLE 221

  Rat   124 -----TLNGE 128
                 ||:||
  Fly   222 KLQNFTLSGE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Id1XP_006235329.1 bHLH_dnHLH_ID1 55..106 CDD:381534 13/46 (28%)
tapNP_524124.1 HLH 155..207 CDD:278439 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.