DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD10

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:200 Identity:56/200 - (28%)
Similarity:97/200 - (48%) Gaps:15/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHT-VELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCE 66
            ::||....|.|||::.:.||...:.|...| :..|..|..:..:.::||...:|.:.|.||.|.|
  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

  Rat    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFP-VFLGEQIRP 130
            |.||::||..||...|..:|:|:|.:|.:::.|.:...||.:|     :.:..:| :||.:....
  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKS-----FSEYYYPQIFLKKPANE 125

  Rat   131 EMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAI-TELMHPVGGGCPVFEGRPRLAAW 194
            |    ....::|..:.| :.||:.:.:..|...||||:..: |.....|.|.  .|:....:|.|
  Fly   126 E----NYKKIEVAFEFL-NTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGF--DFKRYANVARW 183

  Rat   195 YRRVE 199
            |...:
  Fly   184 YENAK 188

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 25/75 (33%)