DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD4

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:204 Identity:54/204 - (26%)
Similarity:89/204 - (43%) Gaps:32/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCES 67
            ::.|....|...|.|.:.||...:......:.:.:||||...|.::||...:|.:.|.||.:.||
  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65

  Rat    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVF----LGEQI 128
            .||.:||..||...|..:|.|.|.||.:::.|.:...||..|.:     |..:|..    ||...
  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFM-----KYYYPFIRTGQLGNAE 125

  Rat   129 RPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGGGCPVFE------- 186
            ..:.:.|....||:        ||:.:|::.|..:::||:..::.:        ..||       
  Fly   126 NYKKVEAAFEFLDI--------FLEGQDYVAGSQLTVADIAILSSV--------STFEVVEFDIS 174

  Rat   187 GRPRLAAWY 195
            ..|.:|.||
  Fly   175 KYPNVARWY 183

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 23/74 (31%)