DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:142 Identity:45/142 - (31%)
Similarity:70/142 - (49%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat    42 SDAFAQVNPMKKVPAMKDG-GFTLCESVAILLYLAHKY----KVPDHWYPQDLQARARVDEYLAW 101
            |..|.:..|..||||.:.. |..|.||.||...||::.    |.|        ..:|:|.:::::
  Fly    43 SAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCP--------FVQAQVQQWISF 99

  Rat   102 -QHTTLRRSCLRTLWHKVMFPVFLGEQIRPEMLAATL-ADLDVNVQVLEDQFLQDKDFLVGPHIS 164
             .:..:..||   .|   :||: ||  |.|:...:|. .:.:..:|.| :|.|||..||.|..|:
  Fly   100 ADNEIVPASC---AW---VFPL-LG--ILPQQKNSTAKQEAEAVLQQL-NQKLQDATFLAGERIT 154

  Rat   165 LADVVAITELMH 176
            |||:|..:.|:|
  Fly   155 LADIVVFSSLLH 166

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 15/36 (42%)