DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD9

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:214 Identity:61/214 - (28%)
Similarity:97/214 - (45%) Gaps:34/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 VLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCE 66
            :|:.|..|.|.|||:|.:.|:...:......|:|..||||...|.::||...:|.:.|.||.:.|
  Fly     1 MLDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE 65

  Rat    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPE 131
            |.|||:|||.||......||:|.|.||.:::.|.:..:||.:|     :....:|....:..:| 
  Fly    66 SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQS-----YVYYYYPQLFEDVKKP- 124

  Rat   132 MLAATLADLDVNVQVLEDQFLQDKDFLVGPH------ISLADVVAITELMHPVGGGCPVFE---- 186
                  ||.| |::.::|.|......|.|..      ::|||...:..:        ..||    
  Fly   125 ------ADPD-NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATV--------STFEISEY 174

  Rat   187 --GR-PRLAAWYRRVEAAV 202
              |: |.:..||...:..:
  Fly   175 DFGKYPEVVRWYDNAKKVI 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 30/74 (41%)