DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE11

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:209 Identity:60/209 - (28%)
Similarity:95/209 - (45%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat     5 LYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCESVA 69
            ||....|.||||:.:.|....:...:..|.::.|||.|..|.::|....:|.:.|.|..:.:|..
  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71

  Rat    70 ILLYLAHKY--KVPDHWYPQDLQARARVDEYLAWQ--HTTLRRSCLRTLWHKVMF---PV-FLGE 126
            |..|||.||  :..|..||:|.:.|..||..|.:.  |          |:.::.|   || :.| 
  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGH----------LFPRIRFIVEPVIYFG- 125

  Rat   127 QIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADV-----VAITELMHPVGGGCPVFE 186
              ..|:.:..:|.|......|| ..|.:.|:|||..:::||:     |:..|...|:..     :
  Fly   126 --AGEVPSDRVAYLQKAYDGLE-HCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEP-----D 182

  Rat   187 GRPRLAAWYRRVEA 200
            ..|||..|.:|::|
  Fly   183 QFPRLVQWVKRIQA 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 23/72 (32%)