DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE8

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:214 Identity:61/214 - (28%)
Similarity:91/214 - (42%) Gaps:25/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCES 67
            |.||....|.|.||..:......||::...:.....|.||..|.:.||...||.::|.|..:.:|
  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDS 68

  Rat    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVF-LGEQIRPE 131
            .||..||..||...|..||:||..||.||:.|.::...:..:.||    .:..|:| .|:...|:
  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLR----GITKPLFATGQTTIPK 129

  Rat   132 MLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGGGCPVF-----EGRPRL 191
                ...|..:.:....:.||...||:.|..:::||...||.:.     ...||     .....:
  Fly   130 ----ERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSIT-----ALAVFVVIDTVKYANI 185

  Rat   192 AAWYRRV------EAAVGK 204
            .||.:|:      |.|.||
  Fly   186 TAWIKRIEELPYYEEACGK 204

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 24/74 (32%)