DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE7

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:194 Identity:57/194 - (29%)
Similarity:96/194 - (49%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Rat    11 SQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCESVAILLYLA 75
            |.|.||:.:......:|::...|..|..|:.|:.|.:.||...||.::|.|..:.:|.||:.||.
  Fly    12 SPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76

  Rat    76 HKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPEMLAATLADL 140
            .||...|..||:||..||.||:.|.::...:..:.||:    :..|:|.|:|   .|:.....|.
  Fly    77 SKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRS----ITKPLFAGKQ---TMIPKERYDA 134

  Rat   141 DVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGGGCPVF-----EGRPRLAAWYRRVE 199
            .:.|....::||...|::.|..:::||...|:.:     ....||     ...||:|||::|::
  Fly   135 IIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTV-----SSLEVFVKVDTTKYPRIAAWFKRLQ 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 21/66 (32%)