DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE6

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:201 Identity:55/201 - (27%)
Similarity:98/201 - (48%) Gaps:15/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 LELY-LDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCE 66
            |.|| || .|.|.||:.:.....|:.::...|::.....||..:.:.||...||.::|.|..:.:
  Fly     4 LTLYGLD-PSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67

  Rat    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPE 131
            |.||:.||..||...|..||:|...||.||:.|.::...:..:.:|::...|:|.   |:...|:
  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ---GQTKVPK 129

  Rat   132 MLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLAD---VVAITELMHPVGGGCPVFEGRPRLAA 193
                ...|..:.:....:.||:.:|::.|..:::||   |.::..|...|......:   ||:.|
  Fly   130 ----ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY---PRIGA 187

  Rat   194 WYRRVE 199
            |.:::|
  Fly   188 WIKKLE 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 24/75 (32%)