DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE5

DIOPT Version :9

Sequence 1:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:202 Identity:57/202 - (28%)
Similarity:95/202 - (47%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCES 67
            |.||....|.|.||:.:......:|::...|.:...|.||:.:.:.||...||.::|.|..:.:|
  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68

  Rat    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLG--EQIRP 130
            .||:.||..||...|..||:||..||.||:.|.::...:..:.::.    :..|:|..  .:|..
  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKA----ITKPLFFNGLNRIPK 129

  Rat   131 EMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLAD---VVAITELMHPVGGGCPVFEGRPRLA 192
            |..     |..|.:....:.||...|::.|..:::||   :.:||.|:..|......:   ||:.
  Fly   130 ERY-----DAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY---PRII 186

  Rat   193 AWYRRVE 199
            .|.||:|
  Fly   187 EWVRRLE 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 23/74 (31%)