DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and MAGIX

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_079135.3 Gene:MAGIX / 79917 HGNCID:30006 Length:334 Species:Homo sapiens


Alignment Length:308 Identity:59/308 - (19%)
Similarity:99/308 - (32%) Gaps:98/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 RMRRQQSSPLL-----QTTSSPAPGAGGFQRSYSTTQRQHHP-HLGGDSYDADQGLLSASYANML 214
            |:||:::..:|     :.|.|..|.|         |...|.| |...::.:|.            
Human    60 RLRRKEAVSVLDSADIEVTDSRLPHA---------TIVDHRPQHRWLETCNAP------------ 103

  Fly   215 QLPQRPHSPAHYAVPPQQQQ-HPQIHQQHASTPFGSTLRFDRAAMSIRERQPRYQPTSSPMQQQ- 277
              ||.....|..|..|.|.. |..:........||.||...|....           .:|:..: 
Human   104 --PQLIQGKARSAPKPSQASGHFSVELVRGYAGFGLTLGGGRDVAG-----------DTPLAVRG 155

  Fly   278 --QQQQQQQQQQLQHTQLAAHLGGSYSSDSYPIYENPSRVISMRATQSQRSESPIYSNTTASSAT 340
              :....|:..:|:...|..|:.|          |:...:...:|.:..|:..|          .
Human   156 LLKDGPAQRCGRLEVGDLVLHING----------ESTQGLTHAQAVERIRAGGP----------Q 200

  Fly   341 LAVVPQHHHQGHLAVPSG------------------SGGGSLSGSGRGGSSGSVRGASTSVQSLY 387
            |.:|.:...:.|...|.|                  .||..::||         |.:|||:.. :
Human   201 LHLVIRRPLETHPGKPRGVGEPRKGVVPSWPDRSPDPGGPEVTGS---------RSSSTSLVQ-H 255

  Fly   388 VPPRTPPSAVAGA-----GGSANGSLQKVPSQQSLTEPEELPLPPG-W 429
            .|.||......|:     ..:|:|.....|.:::....:::|..|| |
Human   256 PPSRTTLKKTRGSPEPSPEAAADGPTVSPPERRAEDPNDQIPGSPGPW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809 3/6 (50%)
MAGIXNP_079135.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PDZ_signaling 124..206 CDD:238492 17/112 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..306 22/105 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.