DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and LOC564220

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_017212193.1 Gene:LOC564220 / 564220 -ID:- Length:1406 Species:Danio rerio


Alignment Length:171 Identity:47/171 - (27%)
Similarity:67/171 - (39%) Gaps:35/171 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VPPRTP------PSAVAGAGGSANGSLQKVPSQQSLTEPEEL-PLPPGWATQYTLHGRKYYIDHN 445
            :|.||.      ||....:|...:|:|: :.:..||...:.| |||..|...||..|..|:||||
Zfish   249 IPERTEEWRKAVPSYTQSSGAGGSGTLE-IRTWSSLPRDDSLEPLPYNWEMAYTETGMVYFIDHN 312

  Fly   446 AHTTHWNHP-----------LEREGLPVGWRRVVSKMHGTYYENQYTGQSQRQHPCL-------- 491
            ..:|.|..|           .|...||.||..:....:||||.:....::|.::|.:        
Zfish   313 TKSTTWLDPRLVKKAKPPEKCEDGELPYGWEEIDDPQYGTYYVDHINQRTQFENPVVEAKRKLGL 377

  Fly   492 -TSYYVYT--TSAEPPKAIRPEASLYAPPTHT-----HNAL 524
             |:....|  .:|.||............||..     |.||
Zfish   378 DTAVATQTQQRAAPPPGGAAGTPGFTRDPTQLKGELYHTAL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809 13/28 (46%)
LOC564220XP_017212193.1 PDZ_signaling 15..98 CDD:238492
NK 120..>198 CDD:327404
WW 291..323 CDD:197736 15/31 (48%)
WW 338..367 CDD:306827 9/28 (32%)
PDZ 412..498 CDD:214570 3/7 (43%)
PDZ 589..664 CDD:214570
PDZ_signaling 733..817 CDD:238492
PDZ_signaling 857..946 CDD:238492
PDZ_signaling 1011..1084 CDD:238492
Neuromodulin_N <1182..>1365 CDD:331332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.