DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and magi2a

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001314782.1 Gene:magi2a / 564112 ZFINID:ZDB-GENE-050810-4 Length:1503 Species:Danio rerio


Alignment Length:229 Identity:52/229 - (22%)
Similarity:84/229 - (36%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 GSYSSDSY----------PIYENPSRVISMRAT---QSQRSESPIYSNTTASSATLAVVPQHHHQ 350
            |:|..:.|          |:..|.:..:...||   |.:|..:...||...:    .:.|....:
Zfish   180 GTYEDNYYGTPKPPAEPSPLLLNVAEQLLPGATPTSQGKRRRNKSVSNMEKA----GIEPPEEEE 240

  Fly   351 GHLAVPSGSG-----------GGSLSGSGRGGSSGSVRGASTSVQSLYVPPRTPPSAVAGAGGSA 404
            ....|.:|:|           ..|...||...::.....::.:.:....||::||..        
Zfish   241 EERPVINGNGVAITPESSEHEDKSTDASGEMATTCPSETSTDAPKEDTEPPKSPPKP-------- 297

  Fly   405 NGSLQKVPSQQSLTEPEEL-PLPPGWATQYTLHGRKYYIDHNAHTTHWNHP-----------LER 457
                         .|.:|| |||..|...||..|..|:||||..||.|..|           .:.
Zfish   298 -------------DENDELGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKE 349

  Fly   458 EGLPVGWRRVVSKMHGTYYENQYTGQSQRQHPCL 491
            ..||.||.::...::||||.:....::|.::|.|
Zfish   350 NELPYGWEKIDDPIYGTYYVDHINRRTQFENPVL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809 14/28 (50%)
magi2aNP_001314782.1 PDZ_signaling 25..100 CDD:238492
NK 122..286 CDD:302627 18/109 (17%)
WW 307..337 CDD:238122 14/29 (48%)
WW 352..381 CDD:278809 9/28 (32%)
PDZ 431..511 CDD:214570
PDZ 595..676 CDD:214570
PDZ 762..856 CDD:214570
PDZ_signaling 920..1007 CDD:238492
PDZ_signaling 1182..1262 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.