DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and magi3a

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001352122.1 Gene:magi3a / 561689 ZFINID:ZDB-GENE-090312-48 Length:1355 Species:Danio rerio


Alignment Length:148 Identity:41/148 - (27%)
Similarity:58/148 - (39%) Gaps:26/148 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 RTPPSAVAGAGGSANGSLQKVPSQQSLTEPEELPLPPGWATQYTLHGRKYYIDHNAHTTHWNHP- 454
            :|.||....:......:...:|...|     :.|||..|...||..|..|:||||:.||.|..| 
Zfish   260 KTVPSYTQSSSSMDFRNWNTMPRDDS-----QDPLPKNWEMAYTETGMVYFIDHNSKTTTWLDPR 319

  Fly   455 ----------LEREGLPVGWRRVVSKMHGTYYENQYTGQSQRQHPCLTSYYVYTTSAEPPKAIRP 509
                      .|...||.||.::....:||||.:....::|.::|.          .|..|.:..
Zfish   320 LAKKAKPPEKCEDGELPYGWEKIEDPQYGTYYVDHINQKTQFENPV----------QEAKKKLSQ 374

  Fly   510 EASLYAPPTHTHNALVPA 527
            |.|....||...:|.|.|
Zfish   375 ETSPTNQPTAAASAAVAA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809 14/28 (50%)
magi3aNP_001352122.1 PDZ_signaling 32..98 CDD:238492
NK 120..>194 CDD:327404
WW 288..320 CDD:197736 16/31 (52%)
WW 335..364 CDD:306827 9/28 (32%)
PDZ 421..502 CDD:214570
PDZ 579..654 CDD:214570
PDZ_signaling 734..818 CDD:238492
PDZ_signaling 862..948 CDD:238492
PDZ_signaling 1032..1105 CDD:238492
MIP-T3 <1177..>1334 CDD:313469
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.