DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and Magi2

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_006535806.1 Gene:Magi2 / 50791 MGIID:1354953 Length:1414 Species:Mus musculus


Alignment Length:187 Identity:49/187 - (26%)
Similarity:71/187 - (37%) Gaps:67/187 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GGSLSGSGRGGSSGSVRGASTSVQSLYV-PPR----------------TPPSA-----VAGAGGS 403
            |.:.|..|:...:.||    |:::...: ||.                ||.|:     .|||.| 
Mouse   205 GATPSAEGKRKRNKSV----TNMEKASIEPPEEEEEERPVVNGNGVVITPESSEHEDKSAGASG- 264

  Fly   404 ANGSLQKVPSQ----QSLTEPEEL-------------------PLPPGWATQYTLHGRKYYIDHN 445
                  :.|||    ...::||||                   |||..|...||..|..|:||||
Mouse   265 ------ETPSQPYPAPVYSQPEELKDQMDDTKPTKPEENEDSDPLPDNWEMAYTEKGEVYFIDHN 323

  Fly   446 AHTTHWNHP-----------LEREGLPVGWRRVVSKMHGTYYENQYTGQSQRQHPCL 491
            ..||.|..|           .:...||.||.::...::||||.:....::|.::|.|
Mouse   324 TKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIYGTYYVDHINRRTQFENPVL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809 14/28 (50%)
Magi2XP_006535806.1 PDZ_signaling 22..96 CDD:238492
NK 118..290 CDD:388413 22/95 (23%)
WW 303..332 CDD:366073 14/28 (50%)
WW 349..378 CDD:366073 9/28 (32%)
PDZ 427..508 CDD:214570
PDZ 601..682 CDD:214570
MAGI_u5 681..755 CDD:374709
PDZ 774..860 CDD:214570
PDZ_signaling 919..1006 CDD:238492
PDZ_signaling 1138..1218 CDD:238492
MAGI_u1 1245..1285 CDD:374706
PHA03307 <1255..>1407 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.