DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and Magix

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001014131.1 Gene:Magix / 317379 RGDID:1549729 Length:326 Species:Rattus norvegicus


Alignment Length:130 Identity:30/130 - (23%)
Similarity:43/130 - (33%) Gaps:44/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 QLQHTQLAAHLGGSYSSDSYPIYENPSRVISMRATQSQRSES-PIYSNTTASSATLAVVPQHHHQ 350
            :|.|..|..|......||                ||..|.|. |:..|..:.::.|   ||...:
  Rat    81 RLPHATLVEHRPQHQRSD----------------TQGPRMEPLPVIQNKASYASRL---PQATGR 126

  Fly   351 GHLAVPSGSGGGSLSGSGRGGSSGSVRGASTSVQSLYVPPRTPPSAVAGAGGSANGSLQKVPSQQ 415
            ..:.:..|..|..|:.||....||:|                 |.||.|.       |:..|:|:
  Rat   127 FSVELVRGPAGFGLTLSGGRNVSGNV-----------------PLAVCGL-------LKDGPAQR 167

  Fly   416  415
              Rat   168  167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809
MagixNP_001014131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
PDZ_signaling 127..209 CDD:238492 15/65 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..267
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.