DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and MAGI3

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001136254.1 Gene:MAGI3 / 260425 HGNCID:29647 Length:1481 Species:Homo sapiens


Alignment Length:153 Identity:42/153 - (27%)
Similarity:61/153 - (39%) Gaps:38/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 SVRGASTSVQSLYVPPRTPP--------SAVAGAGGSANGS--------LQKVPS---------- 413
            |.|..:|||..:.....:.|        .|:.|:|.:.|..        ::.|||          
Human   218 SQRKRTTSVSKMERMDSSLPEEEEDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSMDF 282

  Fly   414 QQSLTEPEEL-PLPPGWATQYTLHGRKYYIDHNAHTTHWNHP-----------LEREGLPVGWRR 466
            :..:...|.| |||..|...||..|..|:||||..||.|..|           .|...||.||.:
Human   283 RNYMMRDETLEPLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEK 347

  Fly   467 VVSKMHGTYYENQYTGQSQRQHP 489
            :....:||||.:....::|.::|
Human   348 IEDPQYGTYYVDHLNQKTQFENP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809 14/28 (50%)
MAGI3NP_001136254.1 Interaction with ADRB1 and TGFA. /evidence=ECO:0000250 18..106
PDZ_signaling 24..101 CDD:238492
NK 123..>197 CDD:327404
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..273 12/54 (22%)
WW 294..326 CDD:197736 16/31 (52%)
WW 342..372 CDD:238122 9/29 (31%)
Interaction with PTEN. /evidence=ECO:0000269|PubMed:10748157 410..492
PDZ 413..493 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..570
PDZ 575..656 CDD:214570
Interaction with ADGRB1. /evidence=ECO:0000269|PubMed:10748157 726..808
PDZ_signaling 726..807 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 821..843
PDZ_signaling 849..935 CDD:238492
Interaction with LPAR2 and GRIN2B. /evidence=ECO:0000269|PubMed:10748157, ECO:0000269|PubMed:16904289 851..938
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 939..976
PDZ_signaling 1022..1100 CDD:238492
Red1 <1132..1461 CDD:311769
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1170..1481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.