DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sav and magi2

DIOPT Version :9

Sequence 1:NP_788721.1 Gene:sav / 252554 FlyBaseID:FBgn0053193 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_031753371.1 Gene:magi2 / 100101686 XenbaseID:XB-GENE-493689 Length:1496 Species:Xenopus tropicalis


Alignment Length:317 Identity:65/317 - (20%)
Similarity:115/317 - (36%) Gaps:83/317 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 GSYSSDSYPIYENPSR--VISMRAT-----------QSQRSESPIYSNTTASSATLAVVPQHHHQ 350
            |:|..:.|...:.|:.  .:.:.||           :.:|..:...||...:    .:.|....:
 Frog   175 GTYEENYYGTPKPPAEPAPLLLNATDHIFPGGIPRVEGKRKRNKSVSNMEKT----GIEPPEEEE 235

  Fly   351 GHLAVPSGSGGGSLSGSGRGGSSGSVRGASTSVQSLYVPPRTPPSAVAGAGGSANGSLQKVPSQQ 415
            ....|.:|:|......|.......:  .||..:.||   |.|.|............:::      
 Frog   236 EERPVVNGNGVAVTPESSEHEDKST--DASGEISSL---PYTAPLYCHSEEKEGTDTIK------ 289

  Fly   416 SLTEPEEL----PLPPGWATQYTLHGRKYYIDHNAHTTHWNHP-----------LEREGLPVGWR 465
             :.:|::.    .||..|...||..|..|:||||..||.|..|           .:...||.||.
 Frog   290 -ILKPDDADELGSLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWE 353

  Fly   466 RVVSKMHGTYYENQYTGQSQRQHPCLTSYYVYTTSAEPPKAIRPEASLYAPPTHTHNALVPANPY 530
            ::...::||||.:....::|.::|.|.:              :.:...::.|: |.....|..|.
 Frog   354 KIDDPIYGTYYVDHINRRTQFENPVLEA--------------KRKLQQHSMPS-TELGTQPMQPQ 403

  Fly   531 LLEEIPKWLAVYSEADSSKDHLLQFNMFSLPELEG-FDSMLVRLFKQELG---TIVG 583
            :..|.|.:     ..|:|             :|:| |.|.:::  |..:|   ||:|
 Frog   404 VFREKPLF-----TRDAS-------------QLKGTFLSTILK--KSNMGFGFTIIG 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
savNP_788721.1 WW 425..454 CDD:278809 14/28 (50%)
magi2XP_031753371.1 PDZ_signaling 15..95 CDD:238492
NK 117..292 CDD:418433 21/132 (16%)
WW 302..331 CDD:395320 14/28 (50%)
WW 348..379 CDD:197736 10/30 (33%)
PDZ_signaling 425..505 CDD:238492 5/18 (28%)
PDZ 601..682 CDD:214570
MAGI_u5 686..757 CDD:406953
PDZ 774..860 CDD:214570
PDZ_signaling 917..1004 CDD:238492
PAT1 <1012..>1133 CDD:401645
PDZ_signaling 1145..1225 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.