DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FUT3 and FucTA

DIOPT Version :9

Sequence 1:NP_000140.1 Gene:FUT3 / 2525 HGNCID:4014 Length:361 Species:Homo sapiens
Sequence 2:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster


Alignment Length:289 Identity:103/289 - (35%)
Similarity:144/289 - (49%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    91 CHITADRKVYPQADTVIVHHWDIMSNPKSRLPPS--PRPQGQRWI--WFNLEPPPNCQHLEALDR 151
            |.:||:|.:...||.::.         |....|:  .||...:.:  .:.||.|.:.|:::..|.
  Fly   205 CELTANRDLASTADMILY---------KDHYIPTGIRRPSNSKQVSMLYYLECPYHTQNVKVPDA 260

Human   152 YFNLTMSYRSDSDIFTPYGWLEPW-----SGQPAHPPLNLSA-KTELVAWAVSNWKPDSARVRYY 210
             .|.|.:||.||.|..||   |.|     ..|.....:|.|. ||:.|||.|||....:.|::|.
  Fly   261 -INWTATYRRDSTIVAPY
---EKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGARNGRLQYA 321

Human   211 QSLQAHLKVDVYGR------SHKPLPKGTMMETLSR-YKFYLAFENSLHPDYITEKLWRNALEAW 268
            ..||.:::||:||.      |.....|  ..|.|.. ||||||||||...||||||.:.|||...
  Fly   322 HELQKYIEVDIYGACGNFKCSRSTADK--CFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRR 384

Human   269 AVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLR-PRSFS 332
            .:|:|:|....:||...|..::||||:|.|||:||.||:.||.|...|.|||:|:.|.. ..::.
  Fly   385 VLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTGEFINTYY 449

Human   333 WALDFCKACWKLQQESRYQTVRSIAAWFT 361
            |    |:.|..|..|.:.:..|    |:|
  Fly   450 W----CRVCATLHNEEQLRKPR----WYT 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FUT3NP_000140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58
Glyco_tran_10_N 60..170 CDD:407214 23/82 (28%)
Glyco_transf_10 189..357 CDD:395683 72/175 (41%)
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 22/81 (27%)
Glyco_transf_10 300..473 CDD:279224 74/181 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5576
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4402
Isobase 1 0.950 - 0 Normalized mean entropy S6520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8516
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.