DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arnt2 and cyc

DIOPT Version :9

Sequence 1:NP_036913.3 Gene:Arnt2 / 25243 RGDID:2154 Length:712 Species:Rattus norvegicus
Sequence 2:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster


Alignment Length:408 Identity:166/408 - (40%)
Similarity:248/408 - (60%) Gaps:36/408 - (8%)


- Green bases have known domain annotations that are detailed below.


  Rat    51 DFDDEDGEGPSKFSR-ENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMK 114
            ::|:|.....|..:| :||||||:|||:||..||.|||.|:|.|.|:.||.||||:|||||.|::
  Fly    17 NYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQHLR 81

  Rat   115 SMRGTGN----KSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQ 175
            .:||:|:    ..:|  |:||||::||||.:||:|::||||||..:.||::||||||:.|||..|
  Fly    82 GIRGSGSLHPFNGSD--YRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVLNSTQ 144

  Rat   176 SEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTG-TVKKEGQQSSMRMCMGSRRSFIC 239
            ::..|.:.::.:||.|:.|::|||.:.|.....|::|.||. .||.:..||..|:|.|:||||.|
  Fly   145 ADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGARRSFFC 209

  Rat   240 RMRCGNA-------PLDHLPLNRITTMRK-RFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMSI 296
            ||:...|       ..|....:|.:|.|| |...|        .:|.|:.||||:|:|.|    |
  Fly   210 RMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTG--------HKYRVIQCTGYLKSWTP----I 262

  Rat   297 PEEDADVGQGSK----YCLVAIGRL--QVTSS--PVCMDMSGMSVPTEFLSRHNSDGIITFVDPR 353
            .:||.|.....:    .|||||||:  .|.:|  |..:|.........|:|||:.:|...|:|.|
  Fly   263 KDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFIDQR 327

  Rat   354 CISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWLLIRTSSF 418
            ...|||:.||::||....|:.|.||.:.|.||.:.|:::..:|.:.:||||.|:..::.:::...
  Fly   328 ATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWR 392

  Rat   419 TFQNPYSDEIEYVICTNT 436
            .|:||::.||:|:|..|:
  Fly   393 AFKNPWTSEIDYIIAKNS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arnt2NP_036913.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..74 10/23 (43%)
bHLH-PAS_ARNT 62..124 CDD:381517 36/66 (55%)
PAS 137..243 CDD:395786 51/106 (48%)
PAS_11 336..436 CDD:405306 36/99 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 573..712
cycNP_524168.2 HLH 31..84 CDD:278439 33/52 (63%)
PAS 111..212 CDD:279347 47/100 (47%)
PAS 111..173 CDD:214512 29/61 (48%)
PAS_11 311..411 CDD:291273 37/100 (37%)
PAS 311..406 CDD:238075 35/94 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168098at33208
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.