DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyro3 and dpr11

DIOPT Version :9

Sequence 1:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:245 Identity:64/245 - (26%)
Similarity:98/245 - (40%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    17 LAGLASLLLPGSAAAGLKLMGAPV-------KMTVSQGQPVKLNCSVEGMDDPDIHW--MKDGAV 72
            ||.::|||...||.:....:..|.       .:|...|....|.|.|:.:.:..:.|  ::||.:
  Fly    95 LAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHI 159

  Rat    73 ------VQNASQVSISISEQNWIGLLSLKSAERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFF 131
                  |..|.|..::|.:.:....|.:|..:..|||.|.|||  ..|.|:|..|.|.|. ||..
  Fly   160 LTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQV--STEPKVSARVQLQVV-VPRT 221

  Rat   132 TV--EPKDLAVPPNVPFQLSCEAVGPPEPVT-IFWWRGPTKVGGPAS------SPSVLNVTGVTQ 187
            .:  || |..|.......|.|...|..||.| |.|:.|..::...:.      .|::...:|..|
  Fly   222 EILGEP-DRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQ 285

  Rat   188 RTEFSCEAHNIK----GLATSRPAIIRLQAPPAAPFNITVTTISSSNASV 233
            .|..|....:.|    |..|..|:     ..|:|...:.:....||.::|
  Fly   286 STIGSLIIESAKKRDTGNYTCSPS-----NSPSATVTLNIINGESSASAV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 27/100 (27%)
IGc2 46..111 CDD:197706 20/72 (28%)
Ig2_Tyro3_like 131..209 CDD:143226 22/90 (24%)
IG_like 135..204 CDD:214653 19/79 (24%)
FN3 215..307 CDD:238020 5/19 (26%)
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
dpr11NP_001262320.1 I-set 125..216 CDD:254352 26/92 (28%)
Ig 127..217 CDD:299845 26/91 (29%)
IG_like 227..320 CDD:214653 23/98 (23%)
IGc2 234..311 CDD:197706 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.