DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyro3 and dpr13

DIOPT Version :9

Sequence 1:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:258 Identity:59/258 - (22%)
Similarity:93/258 - (36%) Gaps:60/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Rat    35 LMGAPV--------KMTVSQGQPVKLNCSVEGMDDPDIHWM--KDGAVV----------QNASQV 79
            |.|.|:        .:|...|....:.|:|..:.:..:.|:  ||..::          :..|..
  Fly   170 LFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSAT 234

  Rat    80 SISISEQNWIGLLSLKSAERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNV 144
            .:..|| :|  .|.:|..:..|||:|.|||.....|.|  .:.|:|.........|....:.|..
  Fly   235 HLKHSE-DW--TLQIKFVQLRDAGVYECQVSTHPPTSI--FLHLSVVEARAEITGPPIRYLTPGS 294

  Rat   145 PFQLSCEAVGPPEPVT-IFWW-----------RGPTKVGGPASSPSVLNVTGVTQRT------EF 191
            ..:|.|..|...|... |||:           ||......|....|.|.:    |||      .|
  Fly   295 TLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTI----QRTRREHSGNF 355

  Rat   192 SCEAHNIKGLATSRPAIIRLQA----PPAAPFNITV---TTISSSNASVAWVPGADGLALLHS 247
            :|.|.|      ::||.:.:..    .|||.::..|   |..:.|...:..:..|.|..:.|:
  Fly   356 TCVASN------TQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIASGYRIFHT 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 24/105 (23%)
IGc2 46..111 CDD:197706 19/76 (25%)
Ig2_Tyro3_like 131..209 CDD:143226 23/95 (24%)
IG_like 135..204 CDD:214653 21/86 (24%)
FN3 215..307 CDD:238020 9/36 (25%)
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
dpr13NP_001033956.2 V-set 180..276 CDD:284989 23/100 (23%)
IG_like 182..262 CDD:214653 19/82 (23%)
IG_like 285..362 CDD:214653 21/86 (24%)
IGc2 292..361 CDD:197706 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.