DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sry and cic

DIOPT Version :9

Sequence 1:	NP_036904.1	Gene:	Sry / 25221	RGDID:	3759	Length:	169	Species:	Rattus norvegicus
Sequence 2:	NP_001262755.1	Gene:	cic / 53560	FlyBaseID:	FBgn0262582	Length:	2150	Species:	Drosophila melanogaster

Alignment Length:	70	Identity:	23/70 - (32%)
Similarity:	44/70 - (62%)	Gaps:	0/70 - (0%)

- Green bases have known domain annotations that are detailed below.

  Rat     5 VKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKHLGYQWKSLTEAEKRPFFQEAQRLKTLHREKY 69
            ::|||||||::|:..|:.:.:::|:..|..:||.||..|.:|...:|..:.:.|..:|..|.:.:
  Fly  1232 IRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLH 1296

  Rat    70 PNYKY 74
            |.:|:
  Fly  1297 PEWKW 1301

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sry	NP_036904.1	Sufficient for interaction with KPNB1. /evidence=ECO:0000250\|UniProtKB:Q05066	4..81		23/70 (33%)
		SOX-TCF_HMG-box	4..74	CDD:238684	22/68 (32%)
		Required for nuclear localization. /evidence=ECO:0000250\|UniProtKB:Q05066	6..22		9/15 (60%)
		Sufficient for interaction with EP300. /evidence=ECO:0000250\|UniProtKB:Q05066	52..84		5/23 (22%)
		Required for nuclear localization. /evidence=ECO:0000250\|UniProtKB:Q05066	75..81		23/70 (33%)
		Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000250\|UniProtKB:Q05738	92..144
		Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000250\|UniProtKB:Q05738	94..138
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..169
cic	NP_001262755.1	DUF4819	349..431	CDD:292708
cic	NP_001262755.1	SOX-TCF_HMG-box	1231..1302	CDD:238684	23/70 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000