powered by:
Protein Alignment Sry and cic
DIOPT Version :9
Sequence 1: | NP_036904.1 |
Gene: | Sry / 25221 |
RGDID: | 3759 |
Length: | 169 |
Species: | Rattus norvegicus |
Sequence 2: | NP_001262755.1 |
Gene: | cic / 53560 |
FlyBaseID: | FBgn0262582 |
Length: | 2150 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 23/70 - (32%) |
Similarity: | 44/70 - (62%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Rat 5 VKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKHLGYQWKSLTEAEKRPFFQEAQRLKTLHREKY 69
::|||||||::|:..|:.:.:::|:..|..:||.||..|.:|...:|..:.:.|..:|..|.:.:
Fly 1232 IRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLH 1296
Rat 70 PNYKY 74
|.:|:
Fly 1297 PEWKW 1301
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.