DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment FUS and MSL1

DIOPT Version :9

Sequence 1:	NP_004951.1	Gene:	FUS / 2521	HGNCID:	4010	Length:	526	Species:	Homo sapiens
Sequence 2:	NP_012274.1	Gene:	MSL1 / 854826	SGDID:	S000001448	Length:	111	Species:	Saccharomyces cerevisiae

Alignment Length:	110	Identity:	25/110 - (22%)
Similarity:	47/110 - (42%)	Gaps:	27/110 - (24%)

- Green bases have known domain annotations that are detailed below.

Human   270 DQGSRHD-SEQDNSDNNTIFVQGLGENVTIE----SVADYFKQIG-IIKTN----KKTGQPMINL 324
            |:.:.|. :|......||::|..|.|.:.::    ::...|...| ::|.:    |:.||..|.:
Yeast    12 DRDTHHTVAEPVTEAKNTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITM 76

Human   325 YTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFA 369
            .|              .|....|:.::   :|:.|.|.|:||.|:
Yeast    77 RT--------------IDQASLAQISL---NGERFFGKPLKVEFS 104

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
FUS	NP_004951.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..286		3/16 (19%)
		RRM_FUS_TAF15	283..368	CDD:240979	21/93 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	375..424
		zf-RanBP	422..449	CDD:279035
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	444..526
MSL1	NP_012274.1	RRM1_U1A_like	29..105	CDD:409692	21/93 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910