DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccnb1 and CycB3

DIOPT Version :9

Sequence 1:NP_741988.1 Gene:Ccnb1 / 25203 RGDID:2291 Length:423 Species:Rattus norvegicus
Sequence 2:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster


Alignment Length:464 Identity:128/464 - (27%)
Similarity:205/464 - (44%) Gaps:120/464 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MALRVTRNTKINTENKAKV------SMAGAKRVPVAVAASKPLLRSRTALGDIGNKVSEQSRIPL 59
            |..|.:...:.:.||..||      ::|..|..|.||.|:|     :|.||::        ::| 
  Fly   132 MTTRASSKVEDSVENCHKVLDKLEEALARPKPRPKAVPAAK-----KTVLGEV--------QLP- 182

  Rat    60 KKETKKLGSGTVTVKALPKPVDKVPVCEPEV-ELDEPEPEPVMEVK------------------- 104
                           |:|.|: ::||..|.. .|..|:...|..|:                   
  Fly   183 ---------------AMPNPM-QIPVLLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALE 231

  Rat   105 -----------------------------HSPEPILVDTPSPSPMETSGCAPAEEYLCQAFSDVI 140
                                         ..|:|:|:..|..:|.:.....|..|          
  Fly   232 DVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPE---------- 286

  Rat   141 LAVSDVDADDGGDPNLCSEYVKDIYAYLRQLEEEQSV---RPKYLLGREVTGNMRAILIDWLIQV 202
             .|.|.|..:..||...|.|..||:.||:..|.|..:   .|:.:   .:|..||.:|:||:::|
  Fly   287 -EVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQI---HLTTWMRTLLVDWMVEV 347

  Rat   203 QMKFRLLQETMYMTVSIIDRFMQDSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTY 267
            |..|.|..||:|:.|.|:|.::....:.|:.|||:|..|.|||.||:|..||.|.||.::.:..|
  Fly   348 QETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAY 412

  Rat   268 TKHQIRQMEMKILRVLNFSLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELSMLDYDMVHFAPS 332
            ...::.:||.:.|||:.:.||.||...||||.::..:|.:...|||:|::|||::||..:.|:.|
  Fly   413 NHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDS 477

  Rat   333 QIAAGAFCLALKI------LDNGEWTPTLQHYLSHTEESLLPVMQHLAKNIVMVNRGLTKH---- 387
            |:|:.|..:||::      ||...||.||.:|..:.       :...|:.:..:|.||.:.    
  Fly   478 QMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQ-------LADFAEIVTALNAGLHRKPRAT 535

  Rat   388 -MTIKNKYA 395
             .||:|||:
  Fly   536 IKTIRNKYS 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccnb1NP_741988.1 Interaction with CDK2. /evidence=ECO:0000250 159..167 3/7 (43%)
Cyclin_N 163..288 CDD:278560 46/127 (36%)
Interaction with CDK2. /evidence=ECO:0000250 248..251 1/2 (50%)
Cyclin_C 290..408 CDD:281044 39/117 (33%)
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 46/127 (36%)
Cyclin_C 435..555 CDD:281044 39/117 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.