DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and YNR064C

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_014462.1 Gene:YNR064C / 855801 SGDID:S000005347 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:77/333 - (23%)
Similarity:118/333 - (35%) Gaps:97/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FLHLMVYDDNKV-----GKKHYP-VLLLHGWPGSVREFYDFIHLLHQTNLDNNNKYIFNVVVPSL 200
            |..:.|.|..||     |....| :|||||:|.|...|.:.|.||...         |:::.|.|
Yeast     8 FHKIQVQDGVKVWYREAGAAGNPTILLLHGFPTSSNMFRNLIPLLAGQ---------FHIIAPDL 63

  Fly   201 PGYGWSQGTSRKGLGPAQVAVMMRNLMLRLGY-------NKFFIQGGDWGSIIGSNIATLYPENV 258
            ||:|:::       .|........:|...:||       .||.:...|:||.:|..:|..:|..:
Yeast    64 PGFGFTE-------TPENYKFSFDSLCESIGYLLDTLSIEKFAMYIFDYGSPVGFRLALKFPSRI 121

  Fly   259 LGYHSNMCNNLSPKSLAKGLVAEFWPSL--FVPSGFEDFFFPKSNEMRYLMEESG---YFHIQAT 318
            .|..:...|     :..:||...||..|  :..|...|..|.|| .:.||.:.:.   .:|    
Yeast   122 TGIVTQNGN-----AYEEGLDDRFWGPLKEYWKSYQSDPVFVKS-LIPYLEDPANVICQYH---- 176

  Fly   319 KPDTIGAALTDNPVGLAAYILEKFSTWTNPSYRSLPDGGLTKRYKMDALLDNLMIYYLTNSITTS 383
              |.:.|..:.:|   |||.|               |..|.:|.....:...|...|..|     
Yeast   177 --DGVPAIESVDP---AAYTL---------------DIALIQRTGQTDIQLRLFFDYQNN----- 216

  Fly   384 QRLYAEQYAQAQRDLHLDRVPTRVP----------TGCARFKSDIMQFLDVQLKDKYTNLVHSTY 438
                .:.|...|:.|...::|..|.          .|...::.|:         |....:.:.| 
Yeast   217 ----IKLYPAFQKFLRDSKIPVLVAWGANDTIFSVAGAEAYRKDV---------DNLKVVYYDT- 267

  Fly   439 HKKGGHFA 446
                ||||
Yeast   268 ----GHFA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 12/31 (39%)
MhpC 159..465 CDD:223669 71/311 (23%)
Abhydrolase_5 159..>255 CDD:289465 29/103 (28%)
YNR064CNP_014462.1 Abhydrolase_1 30..275 CDD:395444 71/311 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2784
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.