DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and ephx2

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001008642.1 Gene:ephx2 / 494099 ZFINID:ZDB-GENE-041212-70 Length:557 Species:Danio rerio


Alignment Length:359 Identity:77/359 - (21%)
Similarity:129/359 - (35%) Gaps:79/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YDDNKVGKK-HY-------PVLLLHGWPGSVREFYDFIHLLHQTNLDNNNKYIFNVVVPSLPGYG 204
            |.:.|.|.| ||       ||||.||:|.|...:...|..|....        |.|:.|.:.|||
Zfish   237 YVNIKPGVKIHYVEMGDGPPVLLCHGFPESWFSWRYQIPALADAG--------FRVLAPDMKGYG 293

  Fly   205 WSQG-TSRKGLGPAQVAVMMRNLMLRLGYNKFFIQGGDWGSIIGSNIATLYPENVLGYHSNMCNN 268
            .|.. ...:.....|:.:.:...:.::...:..:.|.|||.::..|:|..:||.|..        
Zfish   294 GSTAPPDIEEYSQEQIMLDLVTFLDKMAIAQVTLVGHDWGGVLVWNMAQFHPERVRA-------- 350

  Fly   269 LSPKSLAKGLVAEFWPSLFVPSGFEDFFFPKSNEMRYLMEESGY-FHIQATKPDTIGAALTDNPV 332
                      ||.....||...       |.:|.|..||....: :.|...||....|.|..|. 
Zfish   351 ----------VASLNTPLFPVD-------PNTNPMEKLMAIPIFDYQIYFQKPGVAEAELEKNL- 397

  Fly   333 GLAAYILEKFSTWTNPSYRSLPDGGLTKRYKM------DALLDNLMIYYLTNSITTSQRLYAEQY 391
             ...:.|...|:.....:..|...|:.:|..:      |....:::      |::..| .|.|||
Zfish   398 -KRTFKLMFISSSDTGGFPKLSPAGVCQRGGLFVGSPDDPPRSSML------SVSALQ-FYTEQY 454

  Fly   392 AQA------------QRD----LHLDRVPTRVPTGCARFKSD--IMQFLDVQLKDKYTNLVHSTY 438
            :::            :|:    :...|....:|........|  ::......:::...||  |..
Zfish   455 SKSGFRGPLNWYRNYERNWRWMVSRPRAKILMPALMVTAGKDPVLLPAFATGMENLIPNL--SRG 517

  Fly   439 H-KKGGHFAALEVPKVLYKDFIDFVETVERKFKI 471
            | ::.||:..:|.|..|.|..|.:::...:|..|
Zfish   518 HIEECGHWTQMERPAELNKILISWLKETHQKASI 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 12/27 (44%)
MhpC 159..465 CDD:223669 69/332 (21%)
Abhydrolase_5 159..>255 CDD:289465 24/96 (25%)
ephx2NP_001008642.1 HAD-1A3-hyp 3..217 CDD:274054
HAD_like <155..203 CDD:304363
Abhydrolase 237..>358 CDD:304388 35/146 (24%)
Abhydrolase_1 255..531 CDD:278959 65/319 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.