DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and Ephx4

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001001804.2 Gene:Ephx4 / 384214 MGIID:2686228 Length:359 Species:Mus musculus


Alignment Length:239 Identity:61/239 - (25%)
Similarity:96/239 - (40%) Gaps:56/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GLRTHFLHLMVYDDNKVGKKHYP-VLLLHGWPGSVREF-YDFIHLLHQTNLDNNNKYIFNVVVPS 199
            |||.|::        ..|::..| :|||||:|    || |.:.|.|.:.      |..:.||...
Mouse    78 GLRFHYV--------AAGERGKPLMLLLHGFP----EFWYSWRHQLREF------KSEYRVVALD 124

  Fly   200 LPGYGWSQGTSRKGLGPAQVAVM-MRNLMLRLGYNKFFIQGGDWGSIIGSNIATLYPENVLGYHS 263
            |.|||.|...:.:........:. :::::..|||:|..:.|.|||.:|...||..|||.::    
Mouse   125 LRGYGESDAPAHQESYKLDCLIADIKDILDSLGYSKCVLIGHDWGGMIAWLIAVCYPEMIM---- 185

  Fly   264 NMCNNLSPKSLAKGLVAEF-WPSLFVP-----------SGFEDFF-FPKSNEMRYLMEE----SG 311
                        |.:|..| .||:|..           |.|..|| .|:..|..:.:.:    ..
Mouse   186 ------------KLIVINFPHPSVFTEYILRHPAQLFRSSFYYFFQIPRFPEFMFSINDFKALKH 238

  Fly   312 YFHIQATKPDTIGAALTDNPVGLAAYILEKFSTWTNP--SYRSL 353
            .|..|:|.....|..||...:....|:..:....:.|  .||::
Mouse   239 LFTSQSTGIGRKGRQLTTEDLEAYVYVFSQPGALSGPINHYRNI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 11/31 (35%)
MhpC 159..465 CDD:223669 56/217 (26%)
Abhydrolase_5 159..>255 CDD:289465 31/98 (32%)
Ephx4NP_001001804.2 MhpC 74..353 CDD:223669 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.