DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and Ephx4

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001099464.1 Gene:Ephx4 / 289440 RGDID:1308891 Length:266 Species:Rattus norvegicus


Alignment Length:215 Identity:56/215 - (26%)
Similarity:86/215 - (40%) Gaps:47/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VLLLHGWPGSVREF-YDFIHLLHQTNLDNNNKYIFNVVVPSLPGYGWSQGTSRKGLGPAQVAVM- 222
            :|||||:|    || |.:.|.|.:.      |..:.||...|.|||.|.....:........:. 
  Rat     1 MLLLHGFP----EFWYSWRHQLREF------KSEYRVVALDLRGYGESDAPIHQESYKLDCLIAD 55

  Fly   223 MRNLMLRLGYNKFFIQGGDWGSIIGSNIATLYPENVLGYHSNMCNNLSPKSLAKGLVAEF-WPSL 286
            :::::..|||||..:.|.|||.:|...||..|||.::                |.:|..| .||:
  Rat    56 IKDVLDSLGYNKCVLIGHDWGGMIAWLIAVCYPEMIM----------------KLIVINFPHPSV 104

  Fly   287 FVP-----------SGFEDFF-FPKSNEMRYLMEE----SGYFHIQATKPDTIGAALTDNPVGLA 335
            |..           |.|..|| .|:..|:.:.:.:    ...|..|:|.....|..||...:...
  Rat   105 FTEYILRHPAQLFRSSFYYFFQIPRLPELMFSINDFKALKHLFTSQSTGIGRKGRQLTTEDLEAY 169

  Fly   336 AYILEKFSTWTNP--SYRSL 353
            .|:..:....:.|  .||::
  Rat   170 VYVFSQPGALSGPINHYRNI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 5/7 (71%)
MhpC 159..465 CDD:223669 56/215 (26%)
Abhydrolase_5 159..>255 CDD:289465 31/96 (32%)
Ephx4NP_001099464.1 MhpC 1..260 CDD:223669 56/215 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.