DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and EPHX4

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_775838.3 Gene:EPHX4 / 253152 HGNCID:23758 Length:362 Species:Homo sapiens


Alignment Length:347 Identity:74/347 - (21%)
Similarity:130/347 - (37%) Gaps:81/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GLRTHFLHLMVYDDNKVGKKHYP-VLLLHGWPGSVREF-YDFIHLLHQTNLDNNNKYIFNVVVPS 199
            |||.|::        ..|::..| :|||||:|    || |.:.:.|.:.      |..:.||...
Human    80 GLRFHYV--------AAGERGKPLMLLLHGFP----EFWYSWRYQLREF------KSEYRVVALD 126

  Fly   200 LPGYGWSQG-TSRKGLGPAQVAVMMRNLMLRLGYNKFFIQGGDWGSIIGSNIATLYPENVLGY-- 261
            |.|||.:.. ..|:......:...:::::..|||:|..:.|.|||.:|...||..|||.|:..  
Human   127 LRGYGETDAPIHRQNYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIV 191

  Fly   262 ----HSNMCNNLSPKSLAKGLVAEFWPSLFVPSGFEDFFFPKSNEMRYLMEESGYFHIQATKPDT 322
                |.|:......:..|:.|.:.::....:| .|.:|.| ..|:.:.|..   .|...:|....
Human   192 INFPHPNVFTEYILRHPAQLLKSSYYYFFQIP-WFPEFMF-SINDFKVLKH---LFTSHSTGIGR 251

  Fly   323 IGAALTDNPVGLAAYILEKFSTWTNP--SYRSLPDGGLTKRYKMDALLDNLMIYYLTNSITTSQR 385
            .|..||...:....|:..:....:.|  .||::                                
Human   252 KGCQLTTEDLEAYIYVFSQPGALSGPINHYRNI-------------------------------- 284

  Fly   386 LYAEQYAQAQRDLHLDRVPTRVPTGCARFKSDIMQFLDVQL----KDKYTNLVHSTYHKKGGHFA 446
                 ::......|:...||.:..|    ::|  .|::|::    |....|....|...:..|:.
Human   285 -----FSCLPLKHHMVTTPTLLLWG----END--AFMEVEMAEVTKIYVKNYFRLTILSEASHWL 338

  Fly   447 ALEVPKVLYKDFIDFVETVERK 468
            ..:.|.::.|....|::...||
Human   339 QQDQPDIVNKLIWTFLKEETRK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 11/31 (35%)
MhpC 159..465 CDD:223669 67/320 (21%)
Abhydrolase_5 159..>255 CDD:289465 30/98 (31%)
EPHX4NP_775838.3 MhpC 76..350 CDD:223669 71/335 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.