DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and C45B11.2

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_505811.2 Gene:C45B11.2 / 179528 WormBaseID:WBGene00008105 Length:280 Species:Caenorhabditis elegans


Alignment Length:70 Identity:13/70 - (18%)
Similarity:29/70 - (41%) Gaps:20/70 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LDPQEWWGDEAQP---KDYE---------AYLKNN--------SEVIGNRLSYPDKTIADLKERL 79
            ::.:.:|....:|   ||.:         ::||.:        |:.|.|:...||...:::...:
 Worm     1 MEDEYFWKKNGRPPVEKDNDRNSIAKLCLSHLKKSASIMKTTYSDCISNKAESPDDFQSNVIYSI 65

  Fly    80 NRTLR 84
            |:..|
 Worm    66 NKKSR 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 4/21 (19%)
MhpC 159..465 CDD:223669
Abhydrolase_5 159..>255 CDD:289465
C45B11.2NP_505811.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.