powered by:
Protein Alignment Jheh1 and C45B11.2
DIOPT Version :9
Sequence 1: | NP_611385.1 |
Gene: | Jheh1 / 251984 |
FlyBaseID: | FBgn0010053 |
Length: | 474 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505811.2 |
Gene: | C45B11.2 / 179528 |
WormBaseID: | WBGene00008105 |
Length: | 280 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 13/70 - (18%) |
Similarity: | 29/70 - (41%) |
Gaps: | 20/70 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 LDPQEWWGDEAQP---KDYE---------AYLKNN--------SEVIGNRLSYPDKTIADLKERL 79
::.:.:|....:| ||.: ::||.: |:.|.|:...||...:::...:
Worm 1 MEDEYFWKKNGRPPVEKDNDRNSIAKLCLSHLKKSASIMKTTYSDCISNKAESPDDFQSNVIYSI 65
Fly 80 NRTLR 84
|:..|
Worm 66 NKKSR 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Jheh1 | NP_611385.1 |
EHN |
64..168 |
CDD:283978 |
4/21 (19%) |
MhpC |
159..465 |
CDD:223669 |
|
Abhydrolase_5 |
159..>255 |
CDD:289465 |
|
C45B11.2 | NP_505811.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2565 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.