DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and ceeh-1

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_497268.1 Gene:ceeh-1 / 175239 WormBaseID:WBGene00019329 Length:404 Species:Caenorhabditis elegans


Alignment Length:385 Identity:81/385 - (21%)
Similarity:131/385 - (34%) Gaps:125/385 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 VVEYWRDDYLPRWREREVFLWQFNHFTTDIQGLRTHFLHLMVYDDNKVGKKHYPVLL-LHGWPG- 168
            |:|.|...|:                  .::.:|.|::        :.|....|::| :||:|. 
 Worm   113 VLEGWDSRYI------------------KLKKVRLHYV--------QTGSDDKPLMLFIHGYPEF 151

  Fly   169 ------SVREFYDFIHLL----HQTNLDNNNKYIFNVVVPSLPGYGWSQGTSRKGLGPAQVAVMM 223
                  .::||.|....:    ...||.:..|::.|..:..|.|                   .:
 Worm   152 WYSWRFQLKEFADKYRCVAIDQRGYNLSDKPKHVDNYSIDELTG-------------------DI 197

  Fly   224 RNLMLRLGYNKFFIQGGDWGSIIGSNIATLYPENVLGYHSNMCNNL-SPKSLAKGLVAEFWPSLF 287
            |:::..|||:|..:...|||.::....|..|||.|   ...:|.|: .|.|..|.:... | |.|
 Worm   198 RDVIEGLGYDKAIVVAHDWGGLVAWQFAEQYPEMV---DKLICCNIPRPGSFRKRIYTS-W-SQF 257

  Fly   288 VPSGFEDFF----FP---------KSNEMRYLMEESGYFHIQATKPDTIGAALTDNPVGLAAYIL 339
            ..|.:..|:    .|         |..|:.:..:|.|   ||..|      ..||          
 Worm   258 RKSWYMFFYQNEKIPEMLCSADDMKMLELCFRAKEIG---IQNNK------NFTD---------- 303

  Fly   340 EKFSTWTNPSYRSLPDGGLTKRYKMDALLDNLMIYYLTNSITTSQRLYAEQYAQAQRDLHLDRVP 404
            |....|   .| |....|.:.:|.         |.|..|.....::         |.||.|: :|
 Worm   304 EDLEAW---KY-SFSMNGASFKYP---------INYYRNIFNAKKQ---------QADLVLE-MP 345

  Fly   405 TRVPTGCARFKSDIMQFLDVQLKDKYTNLVHSTYHKKGG--HFAALEVPKVLYKDFIDFV 462
            |.:..|.|....||...:     |....|...|..|..|  |:...:.|:::.:....|:
 Worm   346 TLIIWGTADGALDIEAAV-----DSLNTLKQGTMKKIEGASHWVQQDEPEMVNEHIKKFL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 11/62 (18%)
MhpC 159..465 CDD:223669 74/332 (22%)
Abhydrolase_5 159..>255 CDD:289465 23/107 (21%)
ceeh-1NP_497268.1 MhpC 119..400 CDD:223669 77/377 (20%)
Abhydrolase 128..>257 CDD:304388 37/160 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.