DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh1 and LOC103693688

DIOPT Version :9

Sequence 1:NP_611385.1 Gene:Jheh1 / 251984 FlyBaseID:FBgn0010053 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_008768102.1 Gene:LOC103693688 / 103693688 RGDID:9191316 Length:133 Species:Rattus norvegicus


Alignment Length:193 Identity:59/193 - (30%)
Similarity:73/193 - (37%) Gaps:83/193 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LLHGWPGSVREFYDFIHLLHQTNLDNNNKYIFNVVVPSLPGYGWSQGTSRKGLGPAQVAVMMRNL 226
            ::|.|.||:.:       |.:.|.||:|.::       |.|..|.....|.|             
  Rat     7 VIHHWAGSISD-------LIRINNDNSNSFV-------LWGLLWCTQARRFG------------- 44

  Fly   227 MLRLGYNKFFIQGGDWGSIIGSNIATLYPENVLGYHSNMCNNLSPKSLAKGLVAEFWPSLFVPSG 291
             ..|||.:             .:|..|||..                                  
  Rat    45 -RFLGYTE-------------KDIELLYPYK---------------------------------- 61

  Fly   292 FEDFFFPKSNEMRYLMEESGYFHIQATKPDTIGAALTDNPVGLAAYILEKFSTWTNPSYRSLP 354
             |..|:.       :|.||||.|||||||||:|.||.|:||||||||||||||||...|...|
  Rat    62 -EKVFYT-------IMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYLGDP 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh1NP_611385.1 EHN 64..168 CDD:283978 2/5 (40%)
MhpC 159..465 CDD:223669 59/193 (31%)
Abhydrolase_5 159..>255 CDD:289465 19/92 (21%)
LOC103693688XP_008768102.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D898504at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.