DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drd5 and Octbeta1R

DIOPT Version :9

Sequence 1:NP_036900.1 Gene:Drd5 / 25195 RGDID:2523 Length:475 Species:Rattus norvegicus
Sequence 2:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster


Alignment Length:377 Identity:132/377 - (35%)
Similarity:199/377 - (52%) Gaps:48/377 - (12%)


- Green bases have known domain annotations that are detailed below.


  Rat    20 QLAQVDAPAGSATPL-GPAQV----VTAGLLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIV 79
            |...:.|..||.... |.:.:    |...::..:|:..:|||:||..:::|.|.||. :||.|:|
  Fly    84 QAQDIQASEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRI-ITNYFVV 147

  Rat    80 SLAVSDLFVALLVMPWKAVAEVAGYWPFGT-FCDIWVAFDIMCSTASILNLCIISVDRYWAISRP 143
            ||||:|:.|||..|.:.|...::|.|.||: .||:|.:||:..|||||::||.||||||:||.:|
  Fly   148 SLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQP 212

  Rat   144 FRYERKMTQRVALVMVGLAWTLSILISFIPVQLNWHRDKAGSQGQEGLLSNGTPWEEGWELEGRT 208
            ..|...||||...:|:.:.|....|:||:|:...|:                |..|....|:...
  Fly   213 LDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWY----------------TTTENYKYLKSNP 261

  Rat   209 ENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISS-------LERAAEHAQSC 266
            ..|:..:|:.|||.||.:||:||..:|:..|.|||:.|..|.|.:..       ||:..:.:|..
  Fly   262 HICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIP 326

  Rat   267 RSRGAYEPDPSLRASIKKETKVFKTLSMIMGVFVCCWLPFFILNCMVPFCSSGDAEGPKTGFPCV 331
            :.|.:.:.:.|..:::::|.|..:||.:||..|:.||||||:...:...|.|           |:
  Fly   327 KPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDS-----------CI 380

  Rat   332 S-ETTFDIFVWFGWANSSLNPIIYA-FNADFRKVFAQLLG-----CSHFCFR 376
            : .....|..|.|:.||:||||||| ||.|||..|.:.|.     ..:||.|
  Fly   381 TPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLFPYAFYFCRR 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drd5NP_036900.1 7tm_1 55..354 CDD:278431 111/307 (36%)
7tm_4 <121..>173 CDD:304433 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..443
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 55/119 (46%)
7tm_1 124..404 CDD:278431 111/307 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.