DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31468 and Cimap1a

DIOPT Version :10

Sequence 1:NP_732890.1 Gene:CG31468 / 251937 FlyBaseID:FBgn0047351 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_081295.2 Gene:Cimap1a / 69287 MGIID:1916537 Length:254 Species:Mus musculus


Alignment Length:64 Identity:24/64 - (37%)
Similarity:30/64 - (46%) Gaps:5/64 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PGPGAYNLPSTFGFKNCDKRMQRSPQFSF-GRSSRACNSPRIPQGPGPADYHVG--KITRYGRP 69
            |||.||.||...|.....|..|  |.||. |||.....|..:.:.||||.|...  ::|::..|
Mouse   137 PGPAAYMLPVVMGPHTVGKVSQ--PSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31468NP_732890.1 None
Cimap1aNP_081295.2 STPGR 1 180..205 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..228
STPGR 2 216..241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.