DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and IRX9

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_181246.1 Gene:IRX9 / 818285 AraportID:AT2G37090 Length:351 Species:Arabidopsis thaliana


Alignment Length:263 Identity:62/263 - (23%)
Similarity:107/263 - (40%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IYAVTPTYPRPAQKAELTR--LSHLFMLLPHLHWIIVEDTNATTPLVRNLLDRAGLEKRSTLLNI 114
            :..|||...:...|..|.|  .:.|.::.|.|.||:||..:            .|.||.|:.:..
plant   117 VIVVTPIITKDRYKNVLLRRMANTLRLVPPPLLWIVVEKHS------------DGEEKSSSTMLR 169

  Fly   115 KTPSEFK--LKGKDPNWIKPRGVEQRNLALAWLRNHVDVDRHSIVFFMDDDNSYSTELFAEMSKI 177
            ||...::  :..:|...::.....||||||..:.:|   ....||.|...:|.|..:.|.::..|
plant   170 KTGIMYRRIVFKEDFTSLESELDHQRNLALRHIEHH---KLSGIVHFAGLNNIYDLDFFVKIRDI 231

  Fly   178 ERGRVGVWPVGLVGG----LMVERPLLTEDGTKVTGFNAAW-------RPERPFPIDMAAFAISM 231
            |  ..|.||:.|:..    ::||.|:.  :.::|.|    |       ..|...||.:::||.:.
plant   232 E--VFGTWPMALLSANRKRVVVEGPVC--ESSQVLG----WHLRKINNETETKPPIHISSFAFNS 288

  Fly   232 DLFIRNP-------------QATFSYEVQRGYQESEILRHLTTRDQLQPLANRCTDVLVWH---- 279
            .: :.:|             |.:..|..|...::...|:.|..:|        |:.:::|.    
plant   289 SI-LWDPERWGRPSSVEGTKQDSIKYVKQVVLEDDTKLKGLPAQD--------CSKIMLWRLKFP 344

  Fly   280 TRT 282
            |||
plant   345 TRT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 62/263 (24%)
IRX9NP_181246.1 PLN02458 1..350 CDD:215252 62/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2254
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D901158at2759
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 1 1.000 - - mtm1177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.