DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and b3gat2

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001025524.1 Gene:b3gat2 / 594928 XenbaseID:XB-GENE-921701 Length:331 Species:Xenopus tropicalis


Alignment Length:256 Identity:125/256 - (48%)
Similarity:158/256 - (61%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QGDTLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNATTPLVRNLLDRAGLEKRS 109
            :.:|:|.|||:||||.||.||||||||::.|..:|.||||:|||:...|.||...|..||:  .|
 Frog    76 KNETVPVIYAITPTYSRPVQKAELTRLANTFRQVPRLHWIVVEDSVHPTELVSRFLAGAGV--TS 138

  Fly   110 TLLNIKTPSEFKLKGKDPNWIKPRGVEQRNLALAWLRNHVD---------VDRHSIVFFMDDDNS 165
            |.|.:.||..:|..|      .||..||||..|||||....         .|...:|||.||||:
 Frog   139 THLYVPTPRRYKRTG------LPRATEQRNAGLAWLRQEYQRPGLRTAQPQDPTGVVFFADDDNT 197

  Fly   166 YSTELFAEMSKIERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAWRPERPFPIDMAAFAIS 230
            ||.|||.||...:  :|.|||||||||...|||:: |:| ||..:...||.:|||.||||.||:|
 Frog   198 YSLELFQEMRTTQ--KVSVWPVGLVGGRRYERPVV-ENG-KVVSWYTGWRADRPFAIDMAGFAVS 258

  Fly   231 MDLFIRNPQATFSYE-VQRGYQESEILRHLTTRDQLQPLANRCTDVLVWHTRTEKTKLAAE 290
            :.:.:.:|:|.|... .|.|.|||:.|:.:|..::|:|.||.||.||||||||||..||.|
 Frog   259 LQVILSSPKAVFKRRGSQPGMQESDFLKQITKVNELEPKANNCTKVLVWHTRTEKVNLANE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 119/243 (49%)
b3gat2NP_001025524.1 GlcAT-I 81..313 CDD:132995 119/243 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10896
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.