DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and b3gat1l

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_012812522.1 Gene:b3gat1l / 594896 XenbaseID:XB-GENE-5956386 Length:342 Species:Xenopus tropicalis


Alignment Length:266 Identity:120/266 - (45%)
Similarity:165/266 - (62%) Gaps:18/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DTLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNATTPLVRNLLDRAGLEKRSTL 111
            :.:||||.:||||.||.|||||.||::.|:.:.:||||:|||:...|.||.|||::||:  ..|.
 Frog    89 EDIPTIYVITPTYTRPVQKAELVRLANTFLHVVNLHWIVVEDSPRKTKLVANLLEKAGI--NFTH 151

  Fly   112 LNIKTPSEFKL-KGKDPNWIKPRGVEQRNLALAWLRNHVDVDR--HSIVFFMDDDNSYSTELFAE 173
            ||:::|...|: ..:.|:. .|||..||||.|.|||::::...  ..:|:|.||||:||.|||.|
 Frog   152 LNVESPRSLKIGLSRTPSH-SPRGTTQRNLGLRWLRDNINASNPPEGVVYFADDDNTYSLELFEE 215

  Fly   174 MSKIERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAWRPERPFPIDMAAFAISMDLFIRNP 238
            |....  .|.||||..||||..|.|.::..| :|.|:...:.|.|||.||||.||||:.|.:..|
 Frog   216 MRYTR--TVSVWPVAFVGGLRFESPRVSPSG-RVVGWKTVFDPNRPFAIDMAGFAISLRLILERP 277

  Fly   239 QATFSYE-VQRGYQESEILRHLTTRDQLQPLANRCTDVLVWHTRTEKTKLAAEEALLKKGQR--S 300
            .|.|..| ::.||||:.:|:.|.|.|.|:..|..||.|||||||.|:      ..|:.:|:|  :
 Frog   278 HANFRLEGIKGGYQETSLLKDLVTMDGLEAKAANCTKVLVWHTRAER------PTLVNEGKRGFT 336

  Fly   301 DGGMEV 306
            |..:||
 Frog   337 DPNIEV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 113/237 (48%)
b3gat1lXP_012812522.1 GlcAT-I 92..323 CDD:132995 113/236 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I2803
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52067
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.