DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and b3gat2

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001003454.1 Gene:b3gat2 / 445060 ZFINID:ZDB-GENE-040801-191 Length:316 Species:Danio rerio


Alignment Length:260 Identity:129/260 - (49%)
Similarity:159/260 - (61%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNATTPLVRNLLDRAGLEKRSTLL 112
            :||.|||:||||.|..||||||||::.|..:|..|||:|||.|:.|.||...|.|.|:  |.|.|
Zfish    73 SLPVIYAITPTYSRAVQKAELTRLANTFRQVPQFHWIVVEDANSHTELVSRFLARCGV--RYTHL 135

  Fly   113 NIKTPSEFKLKGKDPNWIKPRGVEQRNLALAWLRNHVDVDRHSIVFFMDDDNSYSTELFAEMSKI 177
            |:.||..||..|      .||..|||||||.|:|.|.......:|||.||||:||.|||.||...
Zfish   136 NVFTPRRFKRTG------MPRATEQRNLALGWIRGHRGSKDKGVVFFADDDNTYSLELFEEMRST 194

  Fly   178 ERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAWRPERPFPIDMAAFAISMDLFIRNPQATF 242
            .  ||.|||||||||...||||: |.| ||.|:...|:.:|||.||||.||:::.:.:.||:|.|
Zfish   195 R--RVSVWPVGLVGGRRYERPLV-EKG-KVVGWYTGWKADRPFAIDMAGFAVNLQVILSNPRALF 255

  Fly   243 SYE-VQRGYQESEILRHLTTRDQLQPLANRCTDVLVWHTRTEKTKLAAEEALLKKGQRSDGGMEV 306
            ... .:.|.|||:.|:.:|..:.|:|.|..||.||||||||||..|..|    .|.|:....:||
Zfish   256 KRRGAKPGMQESDFLKQITKVEDLEPKAKNCTQVLVWHTRTEKVNLGNE----PKRQQDSVFIEV 316

  Fly   307  306
            Zfish   317  316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 120/234 (51%)
b3gat2NP_001003454.1 GlcAT-I 75..298 CDD:132995 120/234 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 215 1.000 Domainoid score I2657
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52067
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 1 1.000 - - otm26592
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.