DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-I and GlcAT-P

DIOPT Version :9

Sequence 1:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster


Alignment Length:273 Identity:99/273 - (36%)
Similarity:141/273 - (51%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NGKRTCQGPEYLQAMFVQGDTLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNAT 92
            ||.:|       :..||.....|.:|.:||||.||.|.||||||.:....:.:|.|:::||.|.|
  Fly   216 NGYKT-------RPTFVAASLPPPLYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKT 273

  Fly    93 TPLVRNLLDRAGLEKRSTLLNIKTPSEFKL-----KGKDPNWIKPRGVEQRNLALAWLRNHVDVD 152
            .|||.:.|||.|:           |.|:.:     |.|.....|||||..||..|.:||.|.   
  Fly   274 NPLVGHTLDRIGV-----------PYEYMVAPMPEKYKQTKKAKPRGVSNRNRGLEYLREHA--- 324

  Fly   153 RHSIVFFMDDDNSYSTELFAEMSKIERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAWRPE 217
            ...:::|.||||:|...:|.:|..|  .:|.:||||||....|..|::  ...|:.|:...|...
  Fly   325 TEGVLYFADDDNTYDISIFEQMRYI--SKVAMWPVGLVTKTGVSSPII--QAGKLVGYYDGWIGG 385

  Fly   218 RPFPIDMAAFAISMDLFIRNPQATFSYEVQRGYQESEILRHLTTRD--QLQPLANRCTDVLVWHT 280
            |.:|:|||.||:|:......|.|...:  :.||:|...||.|...|  :::.||:.|.|:|.|||
  Fly   386 RKYPVDMAGFAVSVKFLKERPNAQMPF--KPGYEEDGFLRSLAPLDDAEIELLADECRDILTWHT 448

  Fly   281 RTEKTKLAAEEAL 293
            :|:|.  |..:||
  Fly   449 QTKKN--APAQAL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 90/240 (38%)
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 90/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I2254
eggNOG 1 0.900 - - E1_KOG1476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101124at50557
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 1 1.000 - - mtm1177
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - P PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
98.820

Return to query results.
Submit another query.